You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Feline |
| Target | IL-1 beta |
| Protein Length | 152 |
| MW | 17.4 kDa |
| Purity | 98% |
| Protein Sequence | AAIQSQDYTFRDISQKSLVLSGSYELRALHLNGQNMNQQVVFRMSFVHGEENSKKIPVVLCIKKNNLYLSCVMKDGKPTLQLEMLDPKVYPKKKMEKRFVFNKTEIKGNVEFESSQFPNWYISTSQAEEMPVFLGNTKGGQDITDFIMESAS |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-1F2
Similar Products
−- Item 1 of 1
Porcine IL-1 beta protein [orb107741]
HPLC, SDS-PAGE
Unconjugated
> 95 % by SDS-PAGE and HPLC analyses
17.6 kDa
10 μg, 100 μg, 500 μg Feline IL1B Protein, His Tag [orb2698715]
> 95%, determined by SDS-PAGE
This protein contains the feline IL1B (NP_001070882.1) (Ala116-Ser267) was expressed with an initial Met.
10 μg, 5 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days