Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Feline M-CSF protein

SKU: orb1215807

Description

The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)) (Gene ID: 101091467).

Research Area

Product Categories/Products/Proteins

Images & Validation

Key Properties

SourceYeast
Biological OriginFeline
TargetM-CSF
Protein Length158
MW18.4 kDa
Purity98%
Protein SequenceEEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Recombinant human CSF1R protein, C-His-Avi (HEK293) [orb1516472]

    > 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC

    Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result. kDa

    100 μg
  • Recombinant human CSF1R protein, C-His-Avi (HEK293), Biotin conjugated [orb2328763]

    > 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC

    Due to glycosylation, the protein migrates to 75-105 kDa based on Tris-Bis PAGE result. kDa

    20 μg
  • Recombinant human CSF1R protein, N-His [orb1516736]

    > 90% as determined by SDS-PAGE

    60 kDa

    100 μg, 500 μg
  • Feline M-CSF Recombinant Protein [orb1819766]

    98%

    18.4 kDa

    Yeast

    5 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

25 μg
$ 470.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry