FGF-2 Protein, Chicken, Recombinant (His)

SKU: orb1979543

Description

Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. FGF-2 Protein, Chicken, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P48800.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Chicken
• Biological Activity: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. FGF-2 Protein, Chicken, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.3 kDa and the accession number is P48800.
• Tag: N-6xHis
• Expression Region: 13-158 aa
• MW: 18.3 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P48800