You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FGF2 |
| Target | FGF2 |
| Protein Sequence | Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Molecular Weight | 31 kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−FGF2 Rabbit Polyclonal Antibody [orb500581]
FC, IF, IHC-Fr, IHC-P
Bovine, Guinea pig, Rabbit, Sheep
Canine, Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlFGF2 Rabbit Polyclonal Antibody [orb10186]
FC, WB
Bovine, Gallus, Rabbit, Rat, Sheep
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlAnti-FGF2 Antibody [orb411605]
IF, IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μlFGF-2 Polyclonal Antibody [orb1411222]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 31, 23, 21 and 17 kDa. The protein is processed to 16 kDa mature form, and the protein may be modified via methylation, phosphorylation and/or sumoylation.

Sample Tissue: Mouse Skeletal Muscle, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.

Rabbit Anti-FGF2 Antibody, Catalog Number: orb578305, Formalin Fixed Paraffin Embedded Tissue: Human Ovary Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: Human A375 cells, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Alexa-546, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Red: FGF2 Blue: Nuclei, Gene Name: FGF2.

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-FGF2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

WB Suggested Anti-FGF2 Antibody Titration: 2 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.
Documents Download
Request a Document
Protocol Information
FGF2 Rabbit Polyclonal Antibody (orb578305)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



















