You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Equine, Human |
| Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FMOD |
| Target | FMOD |
| Protein Sequence | Synthetic peptide located within the following region: VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER |
| Molecular Weight | 43kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Fibromodulin Rabbit Polyclonal Antibody [orb156874]
IF, IHC-Fr, IHC-P
Human, Mouse, Sheep
Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlAnti-Fibromodulin Antibody [orb341056]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Hela, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Tissue: Human RPMI 8226 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human kidney (KI), Antibody concentration: 1 ug/ml.

Sample Type: Equine Cartilage Explants, Primary dilution: 1:500.

WB Suggested Anti-FMOD Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.
Documents Download
Request a Document
FMOD Rabbit Polyclonal Antibody (orb582408)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








