You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | ELISA, IHC-P, WB |
|---|---|
| Reactivity | Human |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone No. | 2D7 |
| Immunogen | FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western Blot detection against Immunogen (37.4 KDa).

Detection limit for recombinant GST tagged FOXA1 is approximately 0.03 ng/ml as a capture antibody.

FOXA1 monoclonal antibody (M01), clone 2D7. Western Blot analysis of FOXA1 expression in HepG2.

Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]

Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody (M01), clone 2D7. Lane 1: FOXA1 transfected lysate (49.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody (M01), clone 2D7 (Cat # orb2292799). GAPDH (36.1 kDa) used as specificity and loading control.
Documents Download
Request a Document
Protocol Information
FOXA1 monoclonal antibody (M01), clone 2D7 (orb2292799)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review