FOXA1 monoclonal antibody (M01), clone 2D7

SKU: orb2292799

Description

Mouse monoclonal antibody raised against a partial recombinant FOXA1.

Images & Validation

• Tested Applications: ELISA, IHC-P, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 2D7
• Immunogen: FOXA1 (NP_004487, 367 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Western Blot detection against Immunogen (37.4 KDa).

Detection limit for recombinant GST tagged FOXA1 is approximately 0.03 ng/ml as a capture antibody.

FOXA1 monoclonal antibody (M01), clone 2D7. Western Blot analysis of FOXA1 expression in HepG2.

Immunoperoxidase of monoclonal antibody to FOXA1 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]

Western Blot analysis of FOXA1 expression in transfected 293T cell line by FOXA1 monoclonal antibody (M01), clone 2D7. Lane 1: FOXA1 transfected lysate (49.1 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of FOXA1 over-expressed 293 cell line, cotransfected with FOXA1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA1 monoclonal antibody (M01), clone 2D7 (Cat # orb2292799). GAPDH (36.1 kDa) used as specificity and loading control.

Quick Database Links

RefSeq (Protein):NP_004487