Gallus IL-2 protein

SKU: orb1215734

Description

The Chicken IL-2 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-2 Biotinylated applications are for cell culture. Chicken IL-2 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-2 Biotinylated Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK) (Gene ID: 373958).

Research Area

Product Categories/Products/Proteins

Images & Validation

−

Key Properties

−

Source	Yeast
Biological Origin	Chicken
Target	IL-2
Protein Length	121
MW	14.0 kDa
Purity	98%
Protein Sequence	ASLSSAKRKPLQTLIKDLEILENIKNKIHLELYTPTETQECTQQTLQCYLGEVVTLKKETEDDTEIKEEFVTAIQNIEKNLKSLTGLNHTGSECKICEANNKKKFPDFLHELTNFVRYLQK

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

IL-2

NCBI Gene ID

373958

NCBI Gene Details

−

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide