You have no items in your shopping cart.
GAPDH monoclonal antibody (M01), clone 3C2
Description
Images & Validation
−| Tested Applications | ELISA, WB |
|---|---|
| Reactivity | Human, Mouse, Rat |
Key Properties
−| Host | Mouse |
|---|---|
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone No. | 3C2 |
| Immunogen | GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Protein Sequence | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Detection limit for recombinant GST tagged GAPDH is 0.03 ng/ml as a capture antibody.

GAPDH monoclonal antibody (M01), clone 3C2 Western Blot analysis of GAPDH expression in A-431.

GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in HeLa.

GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in NIH/3T3.

GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in PC-12.

GAPDH monoclonal antibody (M01), clone 3C2. Western Blot analysis of GAPDH expression in Raw 264.7.

Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody (M01), clone 3C2. Lane 1: GAPDH transfected lysate (36.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.84 KDa).
Documents Download
Request a Document
Protocol Information
GAPDH monoclonal antibody (M01), clone 3C2 (orb2292924)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review