You have no items in your shopping cart.
Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His)
SKU: orb1979424
Description
Research Area
,Recombinant-Protein
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Expression System | P. pastoris (Yeast) |
|---|---|
| Biological Origin | Canine |
| Biological Activity | Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His) is expressed in Yeast. |
| Tag | C-10xHis |
| Expression Region | 25-120 aa |
| MW | 12.7 kDa (predicted) |
| Purity | 98.00% |
| Protein Sequence | FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Glycoprotein hormones alpha chain Protein, Canine, Recombinant (His & Myc) [orb1979423]
98.00%
18.1 kDa (predicted)
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide