GPR75 Rabbit Polyclonal Antibody

SKU: orb574512

Description

Rabbit polyclonal antibody to GPR75

Research Area

Product Categories/Antibodies/Primary Antibodies,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Membrane Protein,Root Catalog/Research Areas/Chromatin & Nuclear Signaling,Root Catalog/Research Areas/DNA\/RNA\/Protein Interactions,Root Catalog/Research Areas/Receptors,Root Catalog/Research Areas/GPCR,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/ELISA Kits/Growth Factors and Hormones

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Application Notes:
  Application Info: Pregnenolone (3?-hydroxypregn-5-en-20-one) is the first steroid to be derived from cholesterol in the pathway of steroidogenesis, and it is the common precursor for all of the adrenal and gonadal steroids. Its production occurs in the mitochondrion by cleavage of the C-20 side chain of cholesterol by the P-450SCC enzyme. Once produced, pregnenolone may be utilized by two pathways of steroidogenesis. Pregnenolone may either be converted to 17-OH pregnenolone via the enzymatic action of 17?-hydroxylase or to progesterone via the enzymatic action of 3?-hydroxysteroid dehydrogenase. Elevated pregnenolone levels occur in forms of congenital adrenal hyperplasia (CAH), due to 3?-hydroxysteroid dehydrogenase deficiency or 17?-hydroxylase deficiencies. Higher levels have also been reported in women with idiopathic hirsutism. Studies on pregnenolone levels in regard to sex and age differences indicate that maximum levels occur at approximately 17 and 16 years of age for women and men, while minimum levels occur at approximately 37 and 38 years of age for women and men, respectively. In general, women were found to have slightly higher values when compared to men. Many areas of pregnenolone physiology remain to be investigated. Current research indicates that the determination of pregnenolone in serum may be useful for studying its metabolite, pregnenolone sulfate, which has been reported to have various effects in the mammalian brain and central nervous system.

  Read more...

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GPR75
• Target: GPR75
• Protein Sequence: Synthetic peptide located within the following region: GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY
• Molecular Weight: 59 kDa
• Purity: > 95%
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ACDC, ADPN, APM1, APM-1, GBP28, ACRP30, ADIPQTL1

Quick Database Links

Gene Symbol

GPR75

UniProt

B2RC02

RefSeq (Protein):NP_006785