You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | ICC, IF, IHC-P, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GPSM2 |
| Target | GPSM2 |
| Protein Sequence | Synthetic peptide located within the following region: YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA |
| Molecular Weight | 76kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GPSM2 Rabbit Polyclonal Antibody [orb330633]
WB
Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Anti-GPSM2 antibody IHC staining of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

GPSM2 antibody - N-terminal region (orb330634) validated by WB using Fetal Liver Lysate at 1 ug/ml.

Sample Tissue: Human HT1080 Whole Cell, Antibody dilution: 1 ug/ml.

Sample Tissue: Human Lung Tumor, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Positive control (+): Human lung (LU), Negative control (-): Human Ovary (OV), Antibody concentration: 1 ug/ml.

IAnti-GPSM2 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Rabbit Anti-GPSM2 Antibody, Paraffin Embedded Tissue: Human Liver, Antibody Concentration: 5 ug/ml.
Documents Download
Request a Document
Protocol Information
GPSM2 Rabbit Polyclonal Antibody (orb330634)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




