GPX5 Protein, Pig, Recombinant (His & Myc)

SKU: orb1976811

Description

May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction. GPX5 Protein, Pig, Recombinant (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 26.1 kDa and the accession number is O18994.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Sus scrofa (Pig)
• Biological Activity: May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction. GPX5 Protein, Pig, Recombinant (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 26.1 kDa and the accession number is O18994.
• Tag: N-6xHis, C-Myc
• Expression Region: 22-219 aa
• MW: 26.1 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

O18994