You have no items in your shopping cart.
Description
Research Area
Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Research Areas/Cancer,Root Catalog/Research Areas/Developmental Biology,Root Catalog/Research Areas/Disease Related,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal
Images & Validation
−Item 1 of 1
| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Grem1 |
| Target | Grem1 |
| Protein Sequence | Synthetic peptide located within the following region: EEGSFQSCSFCKPKKFTTMMVTLNCPELQPPTKKKRVTRVKQCRCISIDL |
| Molecular Weight | 21kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti Grem1 antibody, anti Grem 1 antibody, anti Gremlin1, antibody, anti Cysteine knot superfamily 1 antibody, anti Down-regulated in Mos-transformed cells protein antibody, anti Cktsf1b1 antibody, anti BMP antagonist 1 antibody, anti Drm antibody, anti Cell proliferation inducing gene 2 protein antibody, anti DAND2 antibody, anti Gremlin 1 like protein antibody, anti Gremlin-1 antibody, anti IHG-2 antibody, anti IHG2 antibody, anti Increased in high glucose protein 2 antibody, anti proliferation-inducing gene 2 antibody
Similar Products
−- Item 1 of 7
- Item 1 of 7
- Item 1 of 2
Grem1 Rabbit Polyclonal Antibody [orb333726]
WB
Bovine, Canine, Equine, Goat, Guinea pig, Human, Rabbit, Zebrafish
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 1
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Sample Type: Mouse Testis lysates, Antibody dilution: 1.0 ug/ml.
Documents Download
Datasheet
Product Information
Request a Document
Grem1 Rabbit Polyclonal Antibody (orb333715)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Free Secondary Antibody (20 ul)0/0
Please add an antibody product to your cart first.
Usually dispatched within 1 - 2 weeks