You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GRSF1 |
| Target | GRSF1 |
| Protein Sequence | Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
| Molecular Weight | 53kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−GRSF1 Rabbit Polyclonal Antibody [orb324853]
WB
Bovine, Mouse, Porcine, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlGRSF1 Rabbit Polyclonal Antibody [orb1545164]
IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRSF1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb324854 with 1:200 dilution. Western blot was performed using orb324854 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: GRSF1 IP with orb324854 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Hela cell lysate, GRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
Documents Download
Request a Document
GRSF1 Rabbit Polyclonal Antibody (orb324854)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


