You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse, Zebrafish |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GSR |
| Target | GSR |
| Protein Sequence | Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
| Molecular Weight | 56kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Glutathione Reductase Rabbit Polyclonal Antibody [orb10757]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Porcine
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl, 200 μlAnti-Glutathione Reductase Antibody [orb411906]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 200 μl, 100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: HepG2, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in HepG2.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GSR is supported by BioGPS gene expression data to be expressed in 721_B.

Lanes: 1: 40 ug mouse heart lysate, 2: 40 ug mouse skeletal muscle lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:10000, Gene Name: GSR.

Rabbit Anti-GSR Antibody, Catalog Number: orb582295, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-GSR Antibody, Positive Control: Lane 1: 10 ug untreated zebrafish head lysate, Lane 2: 10 ug 3hr H2O2 treated zebrafish head lysate, Lane 3: 10 ug 6hr H2O2 treated zebrafish head lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti rabbit-HRP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-GSR Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Hela cell lysate.
Documents Download
Request a Document
Protocol Information
GSR Rabbit Polyclonal Antibody (orb582295)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review












