Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc)

SKU: orb1979102

Description

Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 25.4 kDa and the accession number is P06934.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: HDV
• Biological Activity: Promotes both transcription and replication of genomic RNA. Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. May interact with host RNA polymerase II thereby changing its template requirement from DNA to RNA. RNA pol II complex would then acts as an RNA-directed RNA polymerase, and transcribe and replicate HDV genome. Hepatitis delta virus genotype I (HDV) Small delta antigen Protein (His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 25.4 kDa and the accession number is P06934.
• Tag: N-6xHis, C-Myc
• Expression Region: 1-195 aa
• MW: 25.4 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P06934