Hepatitis delta virus genotype I (HDV) Large delta antigen Protein (His & Myc)

SKU: orb1979103

Description

Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication. Hepatitis delta virus genotype I (HDV) Large delta antigen Protein (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 27.7 kDa and the accession number is P0C6L6.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: HDV
• Biological Activity: Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication. Hepatitis delta virus genotype I (HDV) Large delta antigen Protein (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 27.7 kDa and the accession number is P0C6L6.
• Tag: N-10xHis, C-Myc
• Expression Region: 1-211 aa
• MW: 27.7 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P0C6L6