Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HIF1A Rabbit Polyclonal Antibody

SKU: orb576507

Description

Rabbit polyclonal antibody to HIF1A

Research Area

Product Categories/Antibodies/Primary Antibodies,Epigenetics,Product Categories/Antibodies,Root Catalog/Products/Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Transcription Regulation,Root Catalog/Research Areas/Hypoxia,Root Catalog/Research Areas/Transcription Factors,Root Catalog/Research Areas/Cell Differentiation,Root Catalog/Products/Polyclonal Antibodies/Trial Size Polyclonal Antibodies,Root Catalog/Products/Polyclonal Antibodies/Enhanced Validation Polyclonal Antibodies,Root Catalog/Products/Primary Antibodies,Root Catalog/Products/Aviva Rabbit Polyclonal

Images & Validation

Tested ApplicationsWB
ReactivityGallus, Human, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HIF1A
TargetHIF1A
Protein SequenceSynthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA
Molecular Weight93kDa
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HIF1, MOP1, PASD8, HIF-1A, bHLHe78, HIF-1alpha, HIF1-ALPHA, HIF-1-alpha

Similar Products

  • HIF-1 Alpha Rabbit Polyclonal Antibody [orb500743]

    FC,  WB

    Gallus, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HIF-1 Alpha Rabbit Polyclonal Antibody [orb500810]

    FC,  ICC

    Gallus, Porcine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HIF-1α Polyclonal Antibody [orb1413487]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • HIF1Alpha Antibody (Center) [orb1928917]

    FC,  IF,  IHC-P,  WB

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • HIF1A Antibody [orb1930780]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HIF1A Rabbit Polyclonal Antibody

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The protein may be modified by glycosylation.

HIF1A Rabbit Polyclonal Antibody

HIF1A antibody - middle region (orb576507) validated by WB using chicken liver.

HIF1A Rabbit Polyclonal Antibody

HIF1A antibody - middle region (orb576507) validated by WB using CoCl2 at 1:500.

HIF1A Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/ml.

HIF1A Rabbit Polyclonal Antibody

Lanes: Lane 1: 80 ug Chicken liver (nuclei), Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit IgG, Secondary Antibody Dilution: 1:2000, Gene Name: HIF1A.

HIF1A Rabbit Polyclonal Antibody

WB Suggested Anti-HIF1A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Small Intestine.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001521

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HIF1A Rabbit Polyclonal Antibody (orb576507)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry