HlgB Protein, S. aureus, Recombinant (His)

SKU: orb1976366

Description

Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. HlgB Protein, S. aureus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P0A075.

Research Area

,Recombinant-Protein

Images & Validation

• Application Notes:
  A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Key Properties

• Expression System: P. pastoris (Yeast)
• Biological Origin: Staphylococcus aureus
• Biological Activity: Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. HlgB Protein, S. aureus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P0A075.
• Tag: N-6xHis
• Expression Region: 26-325 aa
• MW: 36.1 kDa (predicted)
• Purity: 98.00%
• Protein Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Storage & Handling

• Storage: -20°C
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

UniProt

P0A075