HMGB1 monoclonal antibody (M03), clone 1B11

SKU: orb2292809

Description

Mouse monoclonal antibody raised against a full length recombinant HMGB1.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 1B11
• Immunogen: HMGB1 (AAH03378.1, 1 a.a. ~ 215 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged HMGB1 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M03), clone 1B11. Lane 1: HMGB1 transfected lysate (25 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (49.39 KDa).

Quick Database Links

RefSeq:AAH03378.1