HNRPM monoclonal antibody (M03), clone 3F7

SKU: orb2292539

Description

Mouse monoclonal antibody raised against a partial recombinant HNRPM.

Images & Validation

• Tested Applications: ELISA, IF, IHC-P, WB
• Reactivity: Human, Mouse, Rat

Key Properties

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a Kappa
• Clone No.: 3F7
• Immunogen: HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Detection limit for recombinant GST tagged HNRPM is approximately 0.1 ng/ml as a capture antibody.

HNRPM monoclonal antibody (M03), clone 3F7 Western Blot analysis of HNRPM expression in HepG2.

HNRPM monoclonal antibody (M03), clone 3F7. Western Blot analysis of HNRNPM expression in A-431.

HNRPM monoclonal antibody (M03), clone 3F7. Western Blot analysis of HNRPM expression in PC-12.

Immunofluorescence of monoclonal antibody to HNRPM on HepG2 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to HNRPM on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.3 KDa).

Quick Database Links

RefSeq (Protein):NP_005959