You have no items in your shopping cart.
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Reactivity | Mouse |
| Predicted Reactivity | Mouse |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse HSD3B6 |
| Target | HSD3B6 |
| Protein Sequence | Synthetic peptide located within the following region: VYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLS |
| Molecular Weight | 42 kDa |
| Purification | Affinity purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−D19210
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_038849.2 |
|---|
Filter by Applications
Filter by Species
Maria Sindhura John, Mahendran Chinnappan, Methinee Artami, Mohini Bhattacharya, Rebecca A Keogh, Jeffrey Kavanaugh, Tripti Sharma, Alexander R Horswill, Tamia A Harris-Tryon Androgens at the skin surface regulate S. aureus pathogenesis through the activation of agr quorum sensing bioRxiv, (2024)
Applications
IF
Reactivity
Mouse
MS John, M Chinnappan, M Artami, M Bhattacharya, RA Keogh, J Kavanaugh, T Sharma Androgens at the skin surface regulate S. aureus pathogenesis through the activation of agr quorum sensing bioRxiv,, (2024)
Applications
IF
Reactivity
Mouse