You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HSPH1 |
| Target | HSPH1 |
| Protein Sequence | Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ |
| Molecular Weight | 97kDa |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Anti-HSPH1 Antibody [orb215017]
IF, IH, WB
Human, Mouse, Primate, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μlHSPH1 Antibody (Center) [orb1931387]
FC, IHC-P, WB
Hamster, Rat
Human
Rabbit
Polyclonal
Unconjugated
400 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. HSPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. HSPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

Rabbit Anti-HSPH1 Antibody, Catalog Number: orb581618, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in endothelial cells in sinusoids, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-HSPH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.
Documents Download
Request a Document
Protocol Information
HSPH1 Rabbit Polyclonal Antibody (orb581618)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review














