You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Metabolism
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 4-265aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 45.5 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ATP-citrate (pro-S-)-lyase Short name, ACL Citrate cleavage enzyme
Similar Products
−- Item 1 of 1
ACLY purified MaxPab mouse polyclonal antibody (B02P) [orb2296475]
WB
Human
Mouse
Polyclonal
Unconjugated
50 μg Human ACLY Protein, His Tag [orb2700605]
> 90%, determined by SDS-PAGE
This protein contains the human ACLY (P53396) (Met 1-Met 1101) was expressed with a polyhistidine tag at the N-terminus and expressed from Baculovirus-Insect Cells.
10 μg, 5 μgATP citrate lyase/ACLY Protein, Human, Recombinant (His) [orb1957197]
96.00%
123 kDa (predicted); 110 kDa (reducing conditions)
50 μg, 100 μg, 200 μg, 500 μgHuman ATP citrate lyase protein [orb754746]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
28.7 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human ACLY protein (orb358644)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks