You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Neuroscience,Signaling Pathways,Signaling Pathways/Apoptotic,Epigenetics,Apoptosis
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 1-195aa |
| Protein Length | Full Length |
| Endotoxins | Not test. |
| MW | 38 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Apoptic death agonist protein, BH3 interacting domain death agonist protein, BH3 interacting domain death agonist p11 protein, BH3 interacting domain death agonist p13 protein, BH3 interacting domain death agonist p15 protein, BH3-interacting domain death agonist p11 protein, BID protein, BID isoform ES(1b) protein, BID isoform L(2) protein, BID isoform Si6 protein, Desmocollin type 4 protein, FP497 protein, p11 BID protein, p13 BID protein, p15 BID protein, p22 BID protein
Similar Products
−BID purified MaxPab rabbit polyclonal antibody (D01P) [orb2295504]
PLA, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μgHuman BID protein [orb391295]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgHuman BID Protein [orb424322]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
1 mg, 2 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



