You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Cell Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 153-240aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 37.2 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVTRRMAEAELVQEGKARKTNPEIQSTLRKRLY |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Apoptosis related cysteine protease, CASP 14, CASP-14, CASP14, Caspase 14 apoptosis related cysteine protease, Caspase 14 precursor, Caspase-14 subunit p10, Caspase14, CASPE_HUMAN, MGC119078, MGC119079, MICE, Mini ICE
Similar Products
−- Item 1 of 1
Human CASP14 protein [orb391356]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human CASP14 Protein, His Tag [orb1552765]
≥90% as determined by SDS-PAGE
This protein contains the human CASP14(Ser2-Gln242) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgHuman CASP14 Protein, His Tag [orb2700572]
> 95%, determined by SDS-PAGE
This protein contains the human CASP14 (NP_0362461) (Ser 2-Gln 242) was expressed with a polyhistide tag at the N-terminus and expressed from E. coli.
50 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks