You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 24-120aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 27.2 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CCL16
Similar Products
−- Item 1 of 1
Human CCL16 protein (Active) [orb359044]
> 97% as determined by SDS-PAGE and HPLC.
11.2 kDa
E.Coli
500 μg, 5 μg, 100 μg - Item 1 of 1
Human CCL16 Protein [orb1471709]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
11 KDa
Mammalian
50 μg, 10 μg Human CCL16 protein [orb391362]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human C-C motif chemokine 16 protein(CCL16) (Active) [orb1650819]
5 μg, 20 μg, 100 μg, 250 μg, 1 mg, 500 μgRecombinant Human HCC-4 (rHu HCC-4/CCL16) [orb1494969]
> 97% by SDS-PAGE and HPLC analyses.
11.2 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids.
Escherichia coli.
1 mg, 20 μg, 5 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human CCL16 protein (orb244076)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks