You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 52-254aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 25.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD137L, TNFSF9, 4-1BBL
Similar Products
−- Item 1 of 2
Human 4-1BB Ligand Protein, mFc-His Tag [orb689407]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 49.8 kDa after removal of the signal peptide.The apparent molecular mass of mFc-4-1BB Ligand-His is approximately 53-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
Recombinant human TNFSF9 (Trimer) protein, N-His (HEK293) [orb1516524]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 50-55 kDa based on Tris-Bis PAGE result. kDa
100 μg, 50 μg Recombinant Human 4-1BBL/TNFSF9/CD137L Protein, His Tag [orb1552989]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF9(Arg71-Glu254) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgHuman 4 1BBL (His) Protein [orb423902]
Greater than 95.0% as determined by SDS-PAGE
Escherichia Coli
1 mg, 5 μg, 20 μgHuman 4 1BBL Protein [orb423901]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks