You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 52-254aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 25.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human 4-1BB Ligand Protein, mFc-His Tag [orb689407]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 49.8 kDa after removal of the signal peptide.The apparent molecular mass of mFc-4-1BB Ligand-His is approximately 53-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant human TNFSF9 (Trimer) protein, N-His (HEK293) [orb1516524]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 50-55 kDa based on Tris-Bis PAGE result. kDa
100 μg, 50 μgRecombinant Human 4-1BBL/TNFSF9/CD137L Protein, His Tag [orb1552989]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF9(Arg71-Glu254) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgHuman 4 1BBL (His) Protein [orb423902]
Greater than 95.0% as determined by SDS-PAGE
Escherichia Coli
1 mg, 5 μg, 20 μgHuman 4 1BBL Protein [orb423901]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CD137L protein (orb245359)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


