You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CD40L-His-Flag at 10μg/ml can bind Human CD40-Fc, the ED50 of Human CD40-Fc is 0.45 ug/ml. |
| Tag | C-terminal Fc-tagged |
| Expression Region | 21-193aa |
| Protein Length | Extracellular Domain |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 46.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5
Similar Products
−- Item 1 of 2
Human CD40LG protein [orb705340]
Greater than 87% as determined by SDS-PAGE.
44.5 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Human CD40LG protein [orb594873]
Greater than 95% as determined by SDS-PAGE.
16.2 kDa
E.coli
500 μg, 1 mg, 10 μg, 50 μg - Item 1 of 1
Human CD40L protein (Active) [orb359197]
> 95% as determined by SDS-PAGE and HPLC.
16.3 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 5
Anti-PU.1/SPI1 Antibody [orb1097960]
ELISA, FC, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μg 
Human TNF Receptor Associated Factor 3 (TRAF3) ELISA Kit [orb2667729]
0.78-50 ng/mL
0.18 ng/mL
48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks