You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Non-Animal,Infectious Diseases,Microbiology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Human coronavirus 229E (HCoV-229E) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Expression Region | 785-873aa |
| Protein Length | Partial |
| Endotoxins | Not test. |
| MW | 17.2 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | DVLQENQKILAASFNKAMTNIVDAFTGVNDAITQTSQALQTVATALNKIQDVVNQQGNSL NHLTSQLRQNFQAISSSIQAIYDRLDTIQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−E2 Peplomer protein
Similar Products
−Human coronavirus 229E Spike glycoprotein protein [orb704940]
Greater than 90% as determined by SDS-PAGE.
60.2 kDa
Mammalian cell
1 mg, 20 μg, 100 μgHuman coronavirus 229E Spike glycoprotein (His & Myc) [orb1978774]
98.00%
17.2 kDa (predicted)
20 μg, 100 μg, 1 mgHuman coronavirus 229E Spike glycoprotein (His) [orb1978775]
98.00%
60.2 kDa (predicted)
20 μg, 100 μgTMPRSS2 Protein, Human, Recombinant (His & Myc) [orb1977681]
98.00%
47.8 kDa (predicted)
500 μg, 100 μg, 20 μgTMPRSS2 Protein, Human, Recombinant (E. coli, His) [orb1977682]
98.00%
46.9 kDa (predicted)
1 mg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Human coronavirus 229E Spike glycoprotein protein (orb704842)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review