You have no items in your shopping cart.
Human coronavirus HKU1 Non-structural protein 4 protein
SKU: orb704952
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Non-Animal,others
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Human coronavirus HKU1 (isolate N5) (HCoV-HKU1) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 1-109aa |
| Protein Length | Full Length |
| Endotoxins | Not test. |
| MW | 18.5 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein
Similar Products
−coronavirus HKU1 Non-structural protein 4 protein [orb704966]
Greater than 85% as determined by SDS-PAGE.
20.0 kDa
E.coli
100 μg, 20 μg, 1 mgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096620]
Greater than 85% as determined by SDS-PAGE.
13.6 kDa
Baculovirus
1 mg, 100 μg, 20 μgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096650]
Greater than 85% as determined by SDS-PAGE.
13.4 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096672]
Greater than 90% as determined by SDS-PAGE.
14 kDa
Yeast
1 mg, 20 μg, 100 μgRecombinant Human coronavirus HKU1 Non-structural protein 4 (4) [orb1096678]
Greater than 90% as determined by SDS-PAGE.
14.1 kDa
Yeast
1 mg, 20 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide