Human CSF1 protein

SKU: orb594716

Description

Recombinant Human Macrophage colony-stimulating factor 1(CSF1),partial (Active)

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Immunology,Epigenetics,Immunology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The ED50 as determined in a cell proliferation assay using M‑NFS‑60 mouse myelogenous leukemia lymphoblast cells is less than 4.16 ng/ml.
• Tag: C-terminal 6xHis-tagged
• Expression Region: 33-255aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• MW: 26.17 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; MCSF; Lanimostim; CSF1

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P09603