You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-Myc-tagged |
| Expression Region | 22-98aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 12.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Interferon Gamma Induced Protein 10kDa (IP10) ELISA Kit [orb775143]
Human
15.63-1000 pg/mL
6 pg/mL
96 T, 48 THuman Interferon Gamma Induced Protein 10kDa (IP-10/CXCL10) ELISA Kit [orb1807392]
Human
7.82-500pg/mL
3.1 pg/mL
48 T, 96 TRecombinant Human gamma-Interferon Inducible Protein 10/CXCL10 [orb1906081]
> 97 % by SDS-PAGE and HPLC analyses.
Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids.
Escherichia coli
500 μg, 5 μg, 100 μgHuman CXCL10 Protein, hFc Tag [orb2321426]
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.8 kDa after removal of the signal peptide.
Mammalian
50 μg, 100 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].




