Human FCER2 Protein

SKU: orb1478086

This product can be custom made

Featured

Description

Recombinant Human Low affinity immunoglobulin epsilon Fc receptor(FCER2),partial

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	E.coli
Biological Origin	Homo sapiens (Human)
Tag	N-terminal 6xHis-tagged
Expression Region	48-248aa
Protein Length	Partial
Endotoxins	Not test.
MW	27.3 kDa
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

(BLAST-2)(C-type lectin domain family 4 member J)(Fc-epsilon-RII)(Immunoglobulin E-binding factor)(Lymphocyte IgE receptor)(CD antigen CD23)

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P06734

UniProt Details

−

No UniProt data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
MW:	Due to glycosylation, the protein migrates to 38-45 kDa based on Tris-Bis PAGE result. kDa

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	49.9 kDa
Source:	E.coli

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	33.2 kDa
Source:	Mammalian cell