You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Developmental Biology,Cancer
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGFreceptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 106 IU/mg. |
| Tag | Tag-Free |
| Expression Region | 25-206aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 19.8 kDa |
| Purity | > 96% as determined by SDSPAGE and HPLC. |
| Protein Sequence | GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4, 300 mM NaCl |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−FGF-4, HST, HST-1, HSTF-1, Heparin-binding growth factor 4
Similar Products
−Human FGF4 protein [orb594752]
Greater than 95% as determined by SDS-PAGE.
16.9 kDa
E.coli
500 μg, 10 μg, 50 μg, 1 mgRecombinant Human Fibroblast growth factor 4 (FGF4) (Active) [orb2657919]
Greater than 95% as determined by SDS-PAGE.
19.3 kDa
Mammalian cell
10 μg, 50 μg, 1 mgRecombinant Human Fibroblast growth factor 4 protein(FGF4) (Active) [orb1650711]
5 μg, 100 μg, 1 mg, 25 μg, 250 μg, 500 μgRecombinant human FGF4 protein (Active,E. coli) [orb2328307]
> 95% as determined by SDS-PAGE
19.4 kDa
500 μg, 50 μg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

