You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Developmental Biology,Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is 1-5 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 1-208aa |
| Protein Length | Full Length |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 23.44 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 5% Trehalos, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9
Similar Products
−Human FGF9 protein (Active) [orb359154]
> 95% as determined by SDS-PAGE and HPLC.
23.3 kDa
E.Coli
5 μg, 100 μg, 500 μgHuman FGF-9 Protein [orb1471703]
Greater than 95% as determined by reducing SDS-PAGE.
23.44 KDa
Mammalian
50 μg, 10 μgHuman FGF9 protein [orb391739]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human Fibroblast growth factor 9 protein(FGF9) (Active) [orb1650709]
20 μg, 100 μg, 1 mg, 250 μg, 500 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


