You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Neuroscience,Signaling Pathways,Signaling Pathways/Apoptotic,Epigenetics,Signal Transduction
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human FGF-12 at 2ug/ml can bind Human FGFR3-Fc, the ED50 of Recombinant Human FGFR3-Fc is 0.5-4 ug/ml. |
| Tag | C-terminal Fc-tagged |
| Expression Region | 23-375aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 64.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Fibroblast growth factor receptor 3; FGFR-3; CD333; FGFR3; JTK4; IIIc
Similar Products
−- Item 1 of 1
Human FGFR3 Protein, His Tag [orb1291775]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 39.0 kDa after removal of the signal peptide. The apparent molecular mass of FGFR3-His is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg - Item 1 of 1
Human FGFR3 protein [orb244208]
Greater than 90% as determined by SDS-PAGE.
42.1 kDa
E.coli
20 μg, 100 μg, 1 mgHuman FGFR3 protein [orb245837]
Greater than 90% as determined by SDS-PAGE.
40.1 kDa
Yeast
1 mg, 20 μg, 100 μgHuman FGFR3 protein [orb54116]
Greater than 90% as determined by SDS-PAGE.
47.4 kDa
Yeast
1 mg, 20 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks