You have no items in your shopping cart.
Featured
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Cancer,Immunology,Epigenetics,Cancer
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined by its ability to support cell attachment and spreading when used as a substratum for cell culture is 0.1-0.5 μg/ml. |
| Tag | Tag-Free |
| Expression Region | 1270-1546aa & 1721-2016aa |
| Protein Length | Dimer |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 62.7 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | PTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPS&AIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITIS WRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPST |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 12.5 mM Sodium Citrate, 1.25% Sucrose, pH 6.2 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−NovoNectin;Fibronectin; FN; Cold-insoluble globulin; CIG; FN; Fibronectin 1
Similar Products
−- Item 1 of 4
FN1 purified MaxPab mouse polyclonal antibody (B01P) [orb2292976]
IF, PLA, WB
Human
Mouse
Polyclonal
Unconjugated
50 μg 
- Item 1 of 1
- Item 1 of 1
Human FN1 Protein, His Tag [orb1173672]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 270.1 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg Human Fibronectin protein [orb705290]
Greater than 90% as determined by SDS-PAGE.
23.6 kDa
E.coli
20 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks