You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human |
| Target | Frizzled-1 |
| Protein Length | 178 |
| MW | 19.4 kDa |
| Purity | 98% |
| Protein Sequence | QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human FZD1 full length protein-synthetic nanodisc [orb1826623]
The human full length FZD1 protein has a MW of 71.2kDa
Mammalian
10 μg, 50 μg, 100 μgHuman FZD1-Strep full length protein-synthetic nanodisc [orb2668831]
The human full length FZD1-Strep protein has a MW of 71.2 kDa
100 μg, 50 μg, 10 μgRecombinant Human Frizzled-1 Protein, Fc & His Tag [orb1551089]
> 92% by SDS-PAGE.
Recombinant Human Frizzled-1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln73-His Tag253) of human Frizzled-1 (Accession #NP_003496.1) fused with an Fc, 6��His Tag at the C-terminus.
100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days