You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human |
| Target | IFN gamma |
| Protein Length | 143 |
| MW | 16.8 kDa |
| Purity | 98% |
| Protein Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ (143) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human IFN gamma protein [orb594774]
Greater than 95% as determined by SDS-PAGE.
16.88 kDa
E.coli
10 μg, 50 μg, 500 μg, 1 mgHuman IFNGR1 Protein, hFc Tag [orb1291003]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 51.9 kDa after removal of the signal peptide. The apparent molecular mass of IFNGR1-hFc is approximately 55-100 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μgRecombinant human IL-18 protein [orb1516425]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 19 kDa based on Tris-Bis PAGE result. kDa
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].








