Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL-13 Recombinant Protein

SKU: orb1820056

Description

The Human IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. Human IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Human IL-13 Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)) (Gene ID: 3596).

Images & Validation

Key Properties

SourceYeast
Biological OriginHuman
TargetIL-13
Protein Length112
MW12.3 kDa
Purity98%
Protein SequenceGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN (112)

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Human IL13 protein [orb594786]

    Greater than 95% as determined by SDS-PAGE.

    13.4 kDa

    Mammalian cell

    1 mg, 500 μg, 50 μg, 10 μg
  • Human IL13 protein (Active) [orb358978]

    > 97% as determined by SDS-PAGE and HPLC.

    12.3 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
  • Human IL13 protein (Active) [orb358979]

    > 97% as determined by SDS-PAGE and HPLC.

    12.5 kDa

    E.Coli

    500 μg, 10 μg, 100 μg
  • Recombinant human IL-13RA1 protein, C-hFc (HEK293) [orb1516409]

    > 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC

    Due to glycosylation, the protein migrates to 78-90 kDa based on Tris-Bis PAGE result. kDa

    50 μg
  • Recombinant human IL-13 protein, N-His-Avi (HEK293) [orb1516421]

    > 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC

    Due to glycosylation, the protein migrates to 15 and 25-45 kDa based on Tris-Bis PAGE result. kDa

    100 μg, 50 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

NCBI Gene Details

No NCBI Gene data available

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

5 μg
$ 260.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry