You have no items in your shopping cart.
Description
Research Area
Product Categories/Products/Proteins
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human |
| Target | IL-8 |
| Protein Length | 79 |
| MW | 9.1 kDa |
| Purity | 98% |
| Protein Sequence | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS (79) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CXCL8
Similar Products
−- Item 1 of 1
Human Interleukin 8 (IL-8) High Sensitivity ELISA Kit [orb1945900]
Human
0.78-50pg/mL
0.17 pg/mL
96 T, 48 T - Item 1 of 1
Human IL8 protein (Active) [orb359142]
> 97% as determined by SDS-PAGE and HPLC.
8.4 kDa
E.Coli
500 μg, 100 μg, 5 μg - Item 1 of 1
Human IL8 protein (Active) [orb359143]
> 96% as determined by SDS-PAGE and HPLC.
8.9 kDa
E.Coli
100 μg, 5 μg, 500 μg 
- Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days