You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Human |
| Target | IL-8 |
| Protein Length | 79 |
| MW | 9.1 kDa |
| Purity | 98% |
| Protein Sequence | EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS (79) |
Storage & Handling
−| Storage | -20°C |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CXCL8
Similar Products
−Human IL8 protein (Active) [orb359142]
> 97% as determined by SDS-PAGE and HPLC.
8.4 kDa
E.Coli
500 μg, 100 μg, 5 μgHuman IL8 protein (Active) [orb359143]
> 96% as determined by SDS-PAGE and HPLC.
8.9 kDa
E.Coli
100 μg, 5 μg, 500 μgHuman IL-8 (C-6His) Protein [orb1471732]
Greater than 95% as determined by reducing SDS-PAGE.
10.1 KDa
Mammalian
10 μg, 50 μgHuman CXCR2 protein [orb358655]
Greater than 90% as determined by SDS-PAGE.
20.6 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant human IL-8 protein, His (HEK293) [orb1817209]
> 90% as determined by SDS-PAGE
9.9 kDa
500 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide



