You have no items in your shopping cart.
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 113-271aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Not test. |
| MW | 20 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Interleukin 1 Receptor Type Ⅰ (IL-1R1) ELISA Kit [orb1807421]
Human
0.16-10ng/mL
0.10 ng/mL
48 T, 96 THuman IL1 alpha protein (Active) [orb358965]
> 97% as determined by SDS-PAGE and HPLC.
18.0 kDa
E.Coli
500 μg, 10 μg, 100 μgRecombinant human IL-1 Alpha protein, His (HEK293) [orb1516668]
> 95% as determined by SDS-PAGE
25 kDa
500 μg, 100 μgHuman IL1A Protein, mFc Tag [orb2321373]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 44.3 kDa after removal of the signal peptide. The apparent molecular mass of IL1A-mFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].





