You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-17RA-Fc at 1μg/ml can bind Human IL-17F-His, the ED50 of Human IL-17F-His is 47.94 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 31-163aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 15.96 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-17F; IL-17F; Cytokine ML-1; Interleukin-24; IL-24; IL17F; IL24
Similar Products
−- Item 1 of 1
Human IL17F protein [orb594813]
Greater than 95% as determined by SDS-PAGE.
14.9 kDa
E.coli
10 μg, 50 μg, 1 mg, 500 μg - Item 1 of 1
Human IL17F protein (Active) [orb358980]
> 95% as determined by SDS-PAGE and HPLC.
15 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 2
IL17F purified MaxPab mouse polyclonal antibody (B01P) [orb2290707]
IHC-P, WB
Human
Mouse
Polyclonal
Unconjugated
50 μg - Item 1 of 1
Human IL17F Protein, His Tag [orb1471791]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 15.7 kDa after removal of the signal peptide. The apparent molecular mass of His-IL17F is approximately 15-25 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human IL17F Protein [orb1477789]
Greater than 85% as determined by SDS-PAGE.
50.1 kDa
E.coli
20 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks