You have no items in your shopping cart.
Human IL3 protein
SKU: orb594806
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is 0.3-1.5 ng/ml. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 16.1 kDa |
| Expression Region | 20-152aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3
Similar Products
−- Item 1 of 1
Human IL3 protein [orb594807]
Greater than 95% as determined by SDS-PAGE.
16.6 kDa
E.coli
1 mg, 500 μg, 10 μg, 50 μg - Item 1 of 1
Human IL3 protein (Active) [orb358969]
> 96% as determined by SDS-PAGE and HPLC.
15.0 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 3
Human IL-3 (N-6His) Protein [orb1471727]
Greater than 95% as determined by reducing SDS-PAGE.
16.6 KDa
Mammalian
10 μg, 50 μg - Item 1 of 2
Recombinant human IL-3R Alpha protein, C-hFc (HEK293) [orb1516416]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 70-80 kDa based on Tris-Bis PAGE result. kDa
100 μg, 50 μg - Item 1 of 1
Human IL3 Protein, hFc Tag [orb1826889]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 41.2 kDa after removal of the signal peptide.
Mammalian
10 μg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human IL3 protein (orb594806)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks