You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Immunology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using PHA-activated human peripheral blood mononuclear cell (PBMC) is 50-300 pg/ml. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 26-177aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 18.4 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Interleukin-7; IL-7; IL7
Similar Products
−- Item 1 of 1
Human IL7 protein [orb594798]
Greater than 95% as determined by SDS-PAGE.
17.5 kDa
E.coli
10 μg, 50 μg, 1 mg, 500 μg - Item 1 of 1
Human IL7 protein (Active) [orb358973]
> 97% as determined by SDS-PAGE and HPLC.
17.4 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 1
Human IL-7 Protein [orb1471778]
Greater than 95% as determined by reducing SDS-PAGE.
17.5 KDa
Mammalian
10 μg, 50 μg - Item 1 of 1
Human IL7 Protein, hFc Tag [orb2321391]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.5 kDa after removal of the signal peptide. The apparent molecular mass of IL7-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks