You have no items in your shopping cart.
Featured
Active
Description
Research Area
Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Cancer
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is 20-80 pg/ml. |
| Tag | Tag-Free |
| Expression Region | 35-205aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/µg as determined by LAL method. |
| MW | 18.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Lymphotoxin-Alpha; LT-Alpha; TNF-Beta; Tumor Necrosis Factor Ligand Superfamily Member 1; LTA; TNFB; TNFSF1
Similar Products
−- Item 1 of 3
Human LTA protein [orb705222]
Greater than 95% as determined by SDS-PAGE.
20.8 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
Human Leukotriene A4 Hydrolase (LTA4H) ELISA Kit [orb1948952]
Human
0.32-20ng/mL
0.19 ng/mL
48 T, 96 T - Item 1 of 1
Human TNF beta Protein [orb1471704]
Greater than 95% as determined by reducing SDS-PAGE.
18.8 KDa
Mammalian
50 μg, 10 μg - Item 1 of 1
LTA purified MaxPab rabbit polyclonal antibody (D01P) [orb2292639]
WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg - Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks