Human MED1 protein

SKU: orb383234

Description

Recombinant human MED1 protein.

Research Area

Product Categories/Products/Proteins,Product Categories/Research Area,Epigenetics,Epigenetics and Nuclear Signaling

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 878-1031aa
• Protein Length: Partial
• Endotoxins: Not test.
• MW: 32.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Activator-recruited cofactor 205KDA component Short name, ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name, PBP Short name, PPAR-binding protein Thyroid hormone receptor-associated protein complex 220KDA component Short name, Trap220 Thyroid receptor-interacting protein 2 Short name, TR-interacting protein 2 Short name, TRIP-2 Vitamin D receptor-interacting protein complex component DRIP205 p53 regulatory protein RB18A

Quick Database Links

UniProt

Q15648