You have no items in your shopping cart.
Description
Images & Validation
−| Tested Applications | FA, HPLC, SDS-PAGE |
|---|
Key Properties
−| Biological Origin | E.coli |
|---|---|
| Biological Activity | Measured by its ability to bind MICA antibody in ELISA. |
| Target | MICA |
| Conjugation | Unconjugated |
| Purity | > 95.0% as determined by RP-HPLC and analysis by SDS-PAGE |
| Protein Sequence | EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH. |
Storage & Handling
−| Storage | Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles. |
|---|---|
| Buffer/Preservatives | Lyophilized from concentrated (1mg/ml) solution containing no additives. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−MHC class polypeptide-related sequence A protein, MIC-A protein, MICA protein, PERB111 protein, HLA-B protein, AS protein, HLAB protein, HLAC protein, SPDA1 protein, HLA-B73 protein, HLA-B-7301 protein
Similar Products
−Human MHC Class I Chain-Related Protein A (MICA) ELISA Kit [orb782330]
Human
1.57-100 ng/mL
0.37 ng/mL
48 T, 96 THuman MICA(MHC class I chain-related protein A) Microsample ELISA Kit [orb2997475]
1.57-100 ng/mL
0.36 ng/mL
96 T, 48 THuman MICA ELISA Kit [orb407592]
Human
1.56 ng/mL-100 ng/mL
0.39 ng/mL
48 T, 10 x 96 T, 5 x 96 T, 96 T, 24 THuman MHC class chain-related gene B protein [orb80177]
FA, HPLC, SDS-PAGE
Unconjugated
> 95.0% as determined by RP-HPLC and analysis by SDS-PAGE
10 μg, 500 μg, 100 μgMICB Protein, Human, Recombinant (hFc) [orb1960637]
98.00%
58.21 kDa (predicted). Due to glycosylation, the protein migrates to 70-80 kDa based on Tris-Bis PAGE result.
1 mg, 500 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
MICA
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
SDS-PAGE
Sodium Dodecyl Sulphate PolyAcrylamide Gel Electrophoresis
HPLC
High-Performance Liquid Chromatography



